Structure of PDB 1ckq Chain A Binding Site BS01

Receptor Information
>1ckq Chain A (length=261) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEI
NEALKKIDPDLGGTLFVSNSSIKPDGGIVEVKDDYGEWRVVLVAEAKHQG
KDIINIRNGLLVGKRGDQDLMAAGNAIERSHKNISEIANFMLSESHFPYV
LFLEGSNFLTENISITRPDGRVVNLEYNSGILNRLDRLTAANYGMPINSN
LCINKFVNHKDKSIMLQAASIYTQGDGREWDSKIMFEIMFDISTTSLRVL
GRDLFEQLTSK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ckq The Integration of Recognition and Cleavage: X-Ray Structures of Pre- Transition State and Post-Reactive DNA-Eco Ri Endonuclease Complexes
Resolution1.85 Å
Binding residue
(original residue number in PDB)		N85 S86 S87 K89 H114 Q115 A138 A139 G140 N141 A142 R145
Binding residue
(residue number reindexed from 1)		N69 S70 S71 K73 H98 Q99 A122 A123 G124 N125 A126 R129
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ckq, PDBe:1ckq, PDBj:1ckq
PDBsum1ckq
PubMed
UniProtP00642|T2E1_ECOLX Type II restriction enzyme EcoRI (Gene Name=ecoRIR)

[Back to BioLiP]