Structure of PDB 1cka Chain A Binding Site BS01

Receptor Information
>1cka Chain A (length=57) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIP
VPYVEKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cka Structural basis for the specific interaction of lysine-containing proline-rich peptides with the N-terminal SH3 domain of c-Crk.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		F141 D147 E149 D150 E166 Q168 W169 P183 P185 Y186
Binding residue
(residue number reindexed from 1)		F8 D14 E16 D17 E33 Q35 W36 P50 P52 Y53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1cka, PDBe:1cka, PDBj:1cka
PDBsum1cka
PubMed7735837
UniProtQ64010|CRK_MOUSE Adapter molecule crk (Gene Name=Crk)

[Back to BioLiP]