Structure of PDB 1cjg Chain A Binding Site BS01

Receptor Information
>1cjg Chain A (length=62) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN
RVAQQLAGKQSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cjg The solution structure of Lac repressor headpiece 62 complexed to a symmetrical lac operator.
ResolutionN/A
Binding residue
(original residue number in PDB)		H29 L56 A57
Binding residue
(residue number reindexed from 1)		H29 L56 A57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cjg, PDBe:1cjg, PDBj:1cjg
PDBsum1cjg
PubMed10647179
UniProtP03023|LACI_ECOLI Lactose operon repressor (Gene Name=lacI)

[Back to BioLiP]