Structure of PDB 1cir Chain A Binding Site BS01

Receptor Information
>1cir Chain A (length=39) Species: 4513 (Hordeum vulgare) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVT
Ligand information
>1cir Chain B (length=24) Species: 4513 (Hordeum vulgare) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EYRIDRVRLFVDKLDNIAQVPRVG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cir Towards the complete structural characterization of a protein folding pathway: the structures of the denatured, transition and native states for the association/folding of two complementary fragments of cleaved chymotrypsin inhibitor 2. Direct evidence for a nucleation-condensation mechanism
ResolutionN/A
Binding residue
(original residue number in PDB)		T3 E4 W5 L8 G10 K11 S12 V13 A16 P25 A27 Q28 I29 I30 L32 V34
Binding residue
(residue number reindexed from 1)		T3 E4 W5 L8 G10 K11 S12 V13 A16 P25 A27 Q28 I29 I30 L32 V34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Biological Process
GO:0009611 response to wounding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cir, PDBe:1cir, PDBj:1cir
PDBsum1cir
PubMed9079381
UniProtP01053|ICI2_HORVU Subtilisin-chymotrypsin inhibitor-2A

[Back to BioLiP]