Structure of PDB 1cfa Chain A Binding Site BS01

Receptor Information
>1cfa Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLQKKIEEIAAKYKHSVVKKCCYDGASVNNDETCEQRAARISLGPRCIKA
FTECCVVASQLRANISHKDMC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cfa Solution structure of a unique C5a semi-synthetic antagonist: implications in receptor binding.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y13 K14 V18 A50 E53 C71
Binding residue
(residue number reindexed from 1)		Y13 K14 V18 A50 E53 C71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006954 inflammatory response
GO:0006956 complement activation
Cellular Component
GO:0005576 extracellular region

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cfa, PDBe:1cfa, PDBj:1cfa
PDBsum1cfa
PubMed9007977
UniProtP01031|CO5_HUMAN Complement C5 (Gene Name=C5)

[Back to BioLiP]