Structure of PDB 1cdw Chain A Binding Site BS01

Receptor Information
>1cdw Chain A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPR
TTALIFSSGKMVCTGAKSEENSRLAARKYARVVQKLGFPAKFLDFKIQNM
VGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSG
KVVLTGAKVRAEIYEAFENIYPILKGFRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1cdw Crystal structure of a human TATA box-binding protein/TATA element complex.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		V165 A194 F210 S212 K214 V216 Q252 N253 L283 F284 I288 R290 L299 T309
Binding residue
(residue number reindexed from 1)		V11 A40 F56 S58 K60 V62 Q98 N99 L129 F130 I134 R136 L145 T155
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cdw, PDBe:1cdw, PDBj:1cdw
PDBsum1cdw
PubMed8643494
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]