Structure of PDB 1cdm Chain A Binding Site BS01

Receptor Information

>1cdm Chain A (length=133) Species: 9913 (Bos taurus)

LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLTMMAEIREAFRVFDKDGNGYISAAELRHVMTNLG
EKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT

Ligand information

>1cdm Chain B (length=18) Species: 10116 (Rattus norvegicus)

FNARRKLKGAILTTMLAT

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1cdm Modulation of calmodulin plasticity in molecular recognition on the basis of x-ray structures.
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): E7 A10 E11 E14 A15 L18 F19 M36 M72 E84 F92 M109 E114 E120 M124 E127 M144 M145
• Binding residue (residue number reindexed from 1): E4 A7 E8 E11 A12 L15 F16 M33 M69 E71 F79 M96 E101 E107 M111 E114 M131 M132

Enzymatic activity

• Catalytic site (original residue number in PDB): V35
• Catalytic site (residue number reindexed from 1): V32

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0019904 protein domain specific binding
• GO:0046872 metal ion binding

Biological Process

• GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
• GO:0060315 negative regulation of ryanodine-sensitive calcium-release channel activity
• GO:0060316 positive regulation of ryanodine-sensitive calcium-release channel activity

Cellular Component

• GO:0000922 spindle pole
• GO:0005737 cytoplasm
• GO:0005819 spindle
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:1cdm, PDBe:1cdm, PDBj:1cdm
• PDBsum: 1cdm
• PubMed: 8259515
• UniProt: P62157|CALM_BOVIN Calmodulin (Gene Name=CALM)