Structure of PDB 1c66 Chain A Binding Site BS01

Receptor Information

>1c66 Chain A (length=162) Species: 10665 (Tequatrovirus T4)

MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAI
GRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALI
NMVFQMGETGVAGFTNSLRMAQQKRWDEAAVNAAKSRWYNQTPNRAKRVI
TTFRTGTWDAYK

Ligand information

• Ligand ID: AR
• InChI: InChI=1S/Ar
• InChIKey: XKRFYHLGVUSROY-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Ar]
• Formula: Ar
• Name: ARGON
• PDB chain: 1c66 Chain A Residue 501

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1c66 Size versus polarizability in protein-ligand interactions: binding of noble gases within engineered cavities in phage T4 lysozyme.
• Resolution: 2.1 Å
• Binding residue (original residue number in PDB): S117 L118
• Binding residue (residue number reindexed from 1): S117 L118
• Annotation score: 1

Enzymatic activity

• Catalytic site (original residue number in PDB): E11 D20
• Catalytic site (residue number reindexed from 1): E11 D20
• Enzyme Commision number: 3.2.1.17: lysozyme.

Gene Ontology

Molecular Function

• GO:0003796 lysozyme activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds

Biological Process

• GO:0009253 peptidoglycan catabolic process
• GO:0016998 cell wall macromolecule catabolic process
• GO:0031640 killing of cells of another organism
• GO:0042742 defense response to bacterium
• GO:0044659 viral release from host cell by cytolysis

Cellular Component

• GO:0030430 host cell cytoplasm

External links

• PDB: RCSB:1c66, PDBe:1c66, PDBj:1c66
• PDBsum: 1c66
• PubMed: 10993735
• UniProt: P00720|ENLYS_BPT4 Endolysin (Gene Name=E)