Structure of PDB 1c5f Chain A Binding Site BS01

Receptor Information
>1c5f Chain A (length=177) Species: 6279 (Brugia malayi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKKDRRRVFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTG
KISGKPLHYKGSTFHRVIKNFMIQGGDFTKGDGTGGESIYGGMFDDEEFV
MKHDEPFVVSMANKGPNTNGSQFFITTTPAPHLNNIHVVFGKVVSGQEVV
TKIEYLKTNSKNRPLADVVILNCGELV
Ligand information
>1c5f Chain B (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTPGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1c5f Crystal Structure of the Complex of Brugia Malayi Cyclophilin and Cyclosporin A.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		R66 F71 M72 Q74 G83 A112 N113 Q122 F124 H132 H137
Binding residue
(residue number reindexed from 1)		R66 F71 M72 Q74 G83 A112 N113 Q122 F124 H132 H137
Enzymatic activity
Catalytic site (original residue number in PDB) R66 F71 Q74 N113 F124 L133 H137
Catalytic site (residue number reindexed from 1) R66 F71 Q74 N113 F124 L133 H137
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1c5f, PDBe:1c5f, PDBj:1c5f
PDBsum1c5f
PubMed10642184
UniProtQ27450|CYP1_BRUMA Peptidyl-prolyl cis-trans isomerase 1 (Gene Name=CYP-1)

[Back to BioLiP]