Structure of PDB 1bvo Chain A Binding Site BS01

Receptor Information
>1bvo Chain A (length=175) Species: 7165 (Anopheles gambiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PYVEITEQPHPKALRFRYECEGRSAGSIPGVNTTAEQKTFPSIQVHGYRG
RAVVVVSCVTKEGPEHKPHPHNLVGKEGCKKGVCTVEINSTTMSYTFNNL
GIQCVKKKDVEEALRLRQEIRVDPFRTGFGHAKEPGSIDLNAVRLCFQVF
LEGQQRGRFTEPLTPVVSDIIYDKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bvo Structure of the specificity domain of the Dorsal homologue Gambif1 bound to DNA.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R62 R64 R70 K155 K221 K222
Binding residue
(residue number reindexed from 1)		R15 R17 R23 K108 K174 K175
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bvo, PDBe:1bvo, PDBj:1bvo
PDBsum1bvo
PubMed10425685
UniProtQ17034

[Back to BioLiP]