Structure of PDB 1bp3 Chain A Binding Site BS01

Receptor Information
>1bp3 Chain A (length=186) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQT
SLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANS
LVYGASDSNVYDLLKDLEERIQTLMGRLEDGSPRTGQIFKQTYSKFDTDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCG
Ligand information
Ligand IDZN
InChIInChI=1S/Zn/q+2
InChIKeyPTFCDOFLOPIGGS-UHFFFAOYSA-N
SMILES
SoftwareSMILES
CACTVS 3.341[Zn++]
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Zn+2]
FormulaZn
NameZINC ION
ChEMBLCHEMBL1236970
DrugBankDB14532
ZINC
PDB chain1bp3 Chain A Residue 500 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bp3 The X-ray structure of a growth hormone-prolactin receptor complex.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		H18 E174
Binding residue
(residue number reindexed from 1)		H18 E170
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005131 growth hormone receptor binding
GO:0005148 prolactin receptor binding
GO:0005179 hormone activity
GO:0005515 protein binding
GO:0008083 growth factor activity
GO:0046872 metal ion binding
GO:0070186 growth hormone activity
Biological Process
GO:0002092 positive regulation of receptor internalization
GO:0007259 cell surface receptor signaling pathway via JAK-STAT
GO:0010828 positive regulation of D-glucose transmembrane transport
GO:0019221 cytokine-mediated signaling pathway
GO:0031667 response to nutrient levels
GO:0032355 response to estradiol
GO:0040018 positive regulation of multicellular organism growth
GO:0043406 positive regulation of MAP kinase activity
GO:0043568 positive regulation of insulin-like growth factor receptor signaling pathway
GO:0045927 positive regulation of growth
GO:0046427 positive regulation of receptor signaling pathway via JAK-STAT
GO:0048513 animal organ development
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0060396 growth hormone receptor signaling pathway
GO:0060397 growth hormone receptor signaling pathway via JAK-STAT
GO:0070977 bone maturation
GO:0097696 cell surface receptor signaling pathway via STAT
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0031904 endosome lumen
GO:0062023 collagen-containing extracellular matrix
GO:0070195 growth hormone receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bp3, PDBe:1bp3, PDBj:1bp3
PDBsum1bp3
PubMed7984244
UniProtP01241|SOMA_HUMAN Somatotropin (Gene Name=GH1)

[Back to BioLiP]