Structure of PDB 1bnk Chain A Binding Site BS01

Receptor Information
>1bnk Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLG
PEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACV
LLRALEPLEGLETMRQLRSRVLKDRELCSGPSKLCQALAINKSFDQRDLA
QDEAVWLERAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bnk Crystal structure of a human alkylbase-DNA repair enzyme complexed to DNA: mechanisms for nucleotide flipping and base excision.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		H136 Y159 Y162 Y165 R201 G217 P218 S219 K220 G263 H266
Binding residue
(residue number reindexed from 1)		H57 Y80 Y83 Y86 R118 G130 P131 S132 K133 G168 H171
Enzymatic activity
Enzyme Commision number 3.2.2.21: DNA-3-methyladenine glycosylase II.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0003905 alkylbase DNA N-glycosylase activity
Biological Process
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bnk, PDBe:1bnk, PDBj:1bnk
PDBsum1bnk
PubMed9790531
UniProtP29372|3MG_HUMAN DNA-3-methyladenine glycosylase (Gene Name=MPG)

[Back to BioLiP]