Structure of PDB 1bmb Chain A Binding Site BS01

Receptor Information
>1bmb Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDV
QHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bmb Structural and conformational requirements for high-affinity binding to the SH2 domain of Grb2(1).
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R67 R86 S88 S90 S96 H107 F108 K109 L120 W121
Binding residue
(residue number reindexed from 1)		R12 R31 S33 S35 S41 H52 F53 K54 L65 W66
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1bmb, PDBe:1bmb, PDBj:1bmb
PDBsum1bmb
PubMed10090780
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]