Structure of PDB 1bl0 Chain A Binding Site BS01

Receptor Information
>1bl0 Chain A (length=116) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQ
YIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHK
YRMTNMQGESRFLHPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bl0 A novel DNA-binding motif in MarA: the first structure for an AraC family transcriptional activator.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		L30 E31 Q45 R46 K49 S55 G57 Q92 T95 K99 P105 H107
Binding residue
(residue number reindexed from 1)		L22 E23 Q37 R38 K41 S47 G49 Q84 T87 K91 P97 H99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0046677 response to antibiotic

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bl0, PDBe:1bl0, PDBj:1bl0
PDBsum1bl0
PubMed9724717
UniProtP0ACH5|MARA_ECOLI Multiple antibiotic resistance protein MarA (Gene Name=marA)

[Back to BioLiP]