Structure of PDB 1bj6 Chain A Binding Site BS01

Receptor Information
>1bj6 Chain A (length=42) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bj6 Structure of the complex between the HIV-1 nucleocapsid protein NCp7 and the single-stranded pentanucleotide d(ACGCC).
ResolutionN/A
Binding residue
(original residue number in PDB)		V13 F16 T24 R26 R32 K33 G35 C36 W37 Q45 M46 K47
Binding residue
(residue number reindexed from 1)		V2 F5 T13 R15 R21 K22 G24 C25 W26 Q34 M35 K36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:1bj6, PDBe:1bj6, PDBj:1bj6
PDBsum1bj6
PubMed9769215
UniProtQ74084

[Back to BioLiP]