Structure of PDB 1bi9 Chain A Binding Site BS01

Receptor Information
>1bi9 Chain A (length=478) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASLQLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEV
QEADKVDIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAT
LATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYF
TFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSA
LYMGALIKEAGFPPGVVNILPGYGPTAGAAIASHIGIDKIAFTGSTEVGK
LIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQC
CTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDPTTEQGPQIDKKQYN
KILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIF
GPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTV
WINCYGEFGLREYSEVKTVTVKIPQKNS
Ligand information
Ligand IDNAD
InChIInChI=1S/C21H27N7O14P2/c22-17-12-19(25-7-24-17)28(8-26-12)21-16(32)14(30)11(41-21)6-39-44(36,37)42-43(34,35)38-5-10-13(29)15(31)20(40-10)27-3-1-2-9(4-27)18(23)33/h1-4,7-8,10-11,13-16,20-21,29-32H,5-6H2,(H5-,22,23,24,25,33,34,35,36,37)/t10-,11-,13-,14-,15-,16-,20-,21-/m1/s1
InChIKeyBAWFJGJZGIEFAR-NNYOXOHSSA-N
SMILES
SoftwareSMILES
CACTVS 3.341NC(=O)c1ccc[n+](c1)[C@@H]2O[C@H](CO[P]([O-])(=O)O[P@](O)(=O)OC[C@H]3O[C@H]([C@H](O)[C@@H]3O)n4cnc5c(N)ncnc45)[C@@H](O)[C@H]2O
OpenEye OEToolkits 1.5.0c1cc(c[n+](c1)C2C(C(C(O2)COP(=O)([O-])OP(=O)(O)OCC3C(C(C(O3)n4cnc5c4ncnc5N)O)O)O)O)C(=O)N
CACTVS 3.341NC(=O)c1ccc[n+](c1)[CH]2O[CH](CO[P]([O-])(=O)O[P](O)(=O)OC[CH]3O[CH]([CH](O)[CH]3O)n4cnc5c(N)ncnc45)[CH](O)[CH]2O
OpenEye OEToolkits 1.5.0c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P@@](=O)([O-])O[P@@](=O)(O)OC[C@@H]3[C@H]([C@H]([C@@H](O3)n4cnc5c4ncnc5N)O)O)O)O)C(=O)N
FormulaC21 H27 N7 O14 P2
NameNICOTINAMIDE-ADENINE-DINUCLEOTIDE
ChEMBLCHEMBL1234613
DrugBankDB14128
ZINC
PDB chain1bi9 Chain A Residue 701 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bi9 The structure of retinal dehydrogenase type II at 2.7 A resolution: implications for retinal specificity.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		I165 I166 W168 K192 A194 E195 G225 G229 A230 F243 S246 V249
Binding residue
(residue number reindexed from 1)		I164 I165 W167 K191 A193 E194 G224 G228 A229 F242 S245 V248
Annotation score4
Enzymatic activity
Catalytic site (original residue number in PDB) N169 K192 E268 C302 E399
Catalytic site (residue number reindexed from 1) N168 K191 E267 C301 E398
Enzyme Commision number 1.2.1.36: retinal dehydrogenase.
Gene Ontology
Molecular Function
GO:0001758 retinal dehydrogenase activity
GO:0004028 3-chloroallyl aldehyde dehydrogenase activity
GO:0004029 aldehyde dehydrogenase (NAD+) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0016918 retinal binding
Biological Process
GO:0001568 blood vessel development
GO:0001822 kidney development
GO:0001889 liver development
GO:0002138 retinoic acid biosynthetic process
GO:0003007 heart morphogenesis
GO:0006629 lipid metabolic process
GO:0007494 midgut development
GO:0008283 cell population proliferation
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0009855 determination of bilateral symmetry
GO:0009952 anterior/posterior pattern specification
GO:0009954 proximal/distal pattern formation
GO:0010628 positive regulation of gene expression
GO:0014032 neural crest cell development
GO:0016331 morphogenesis of embryonic epithelium
GO:0021915 neural tube development
GO:0021983 pituitary gland development
GO:0030182 neuron differentiation
GO:0030324 lung development
GO:0030326 embryonic limb morphogenesis
GO:0030900 forebrain development
GO:0030902 hindbrain development
GO:0031016 pancreas development
GO:0031076 embryonic camera-type eye development
GO:0032355 response to estradiol
GO:0032526 response to retinoic acid
GO:0033189 response to vitamin A
GO:0034097 response to cytokine
GO:0035115 embryonic forelimb morphogenesis
GO:0035799 ureter maturation
GO:0042572 retinol metabolic process
GO:0042573 retinoic acid metabolic process
GO:0042574 retinal metabolic process
GO:0042904 9-cis-retinoic acid biosynthetic process
GO:0043010 camera-type eye development
GO:0043065 positive regulation of apoptotic process
GO:0048384 retinoic acid receptor signaling pathway
GO:0048566 embryonic digestive tract development
GO:0048738 cardiac muscle tissue development
GO:0051289 protein homotetramerization
GO:0060324 face development
GO:0071300 cellular response to retinoic acid
GO:1905562 regulation of vascular endothelial cell proliferation
Cellular Component
GO:0005737 cytoplasm
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bi9, PDBe:1bi9, PDBj:1bi9
PDBsum1bi9
PubMed10320326
UniProtQ63639|AL1A2_RAT Retinal dehydrogenase 2 (Gene Name=Aldh1a2)

[Back to BioLiP]