Structure of PDB 1bhf Chain A Binding Site BS01

Receptor Information
>1bhf Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFD
QNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLS
RPCQT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bhf Carboxymethyl-phenylalanine as a replacement for phosphotyrosine in SH2 domain binding.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
R134 R154 S156 E157 S158 S164 K179 H180 Y181 K182 G215
Binding residue
(residue number reindexed from 1)
R13 R33 S35 E36 S37 S43 K58 H59 Y60 K61 G94
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1bhf, PDBe:1bhf, PDBj:1bhf
PDBsum1bhf
PubMed9685372
UniProtP06239|LCK_HUMAN Tyrosine-protein kinase Lck (Gene Name=LCK)

[Back to BioLiP]