Structure of PDB 1be9 Chain A Binding Site BS01

Receptor Information
>1be9 Chain A (length=115) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FLGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLS
GELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRF
EANSRVNSSGRIVTN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1be9 Crystal structures of a complexed and peptide-free membrane protein-binding domain: molecular basis of peptide recognition by PDZ.
Resolution1.82 Å
Binding residue
(original residue number in PDB)		G322 L323 G324 F325 N326 I327 I328 S339 H372
Binding residue
(residue number reindexed from 1)		G22 L23 G24 F25 N26 I27 I28 S39 H72
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1be9, PDBe:1be9, PDBj:1be9
PDBsum1be9
PubMed8674113
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]