Structure of PDB 1bdt Chain A Binding Site BS01

Receptor Information
>1bdt Chain A (length=52) Species: 10754 (Lederbergvirus P22) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGR
IG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bdt Origins of DNA-binding specificity: role of protein contacts with the DNA backbone.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M1 M4 R23 S32 V33
Binding residue
(residue number reindexed from 1)		M1 M4 R23 S32 V33
Binding affinityPDBbind-CN: Kd=12pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bdt, PDBe:1bdt, PDBj:1bdt
PDBsum1bdt
PubMed9927650
UniProtP03050|RARC_BPP22 Transcriptional repressor arc (Gene Name=arc)

[Back to BioLiP]