Structure of PDB 1bdh Chain A Binding Site BS01

Receptor Information
>1bdh Chain A (length=338) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVAR
SLAVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLE
KQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKA
DFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMK
AMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAM
GALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAF
NMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1bdh Crystal Structure of LacI Member, PurR, Bound to DNA: Minor Groove Binding by Alpha Helices
Resolution2.7 Å
Binding residue
(original residue number in PDB)		S14 T16 T17 R26 V28 A29 T32 L54 A55
Binding residue
(residue number reindexed from 1)		S12 T14 T15 R24 V26 A27 T30 L52 A53
Binding affinityPDBbind-CN: Kd=900nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0002057 guanine binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006164 purine nucleotide biosynthetic process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900372 negative regulation of purine nucleotide biosynthetic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bdh, PDBe:1bdh, PDBj:1bdh
PDBsum1bdh
PubMed
UniProtP0ACP7|PURR_ECOLI HTH-type transcriptional repressor PurR (Gene Name=purR)

[Back to BioLiP]