Structure of PDB 1bbz Chain A Binding Site BS01

Receptor Information

>1bbz Chain A (length=58) Species: 9606 (Homo sapiens)

NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
NYITPVNS

Ligand information

>1bbz Chain B (length=10)

APSYSPPPPP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1bbz Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions.
• Resolution: 1.65 Å
• Binding residue (original residue number in PDB): Y7 D14 E35 W36 W47 P49 Y52
• Binding residue (residue number reindexed from 1): Y7 D14 E35 W36 W47 P49 Y52

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:1bbz, PDBe:1bbz, PDBj:1bbz
• PDBsum: 1bbz
• PubMed: 9698566
• UniProt: P00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)