Structure of PDB 1b72 Chain A Binding Site BS01

Receptor Information
>1b72 Chain A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARTFDWMKVLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQ
VKIWFQNRRMKQKKRERE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b72 Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		R207 T208 F210 N253
Binding residue
(residue number reindexed from 1)		R11 T12 F14 N57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1b72, PDBe:1b72, PDBj:1b72
PDBsum1b72
PubMed10052460
UniProtP14653|HXB1_HUMAN Homeobox protein Hox-B1 (Gene Name=HOXB1)

[Back to BioLiP]