Structure of PDB 1b07 Chain A Binding Site BS01

Receptor Information
>1b07 Chain A (length=59) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMI
PVPYVEKYH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b07 Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		F141 N146 D150 E166 Q168 W169 Y186
Binding residue
(residue number reindexed from 1)		F9 N14 D18 E34 Q36 W37 Y54
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1b07, PDBe:1b07, PDBj:1b07
PDBsum1b07
PubMed9851931
UniProtQ64010|CRK_MOUSE Adapter molecule crk (Gene Name=Crk)

[Back to BioLiP]