Structure of PDB 1b01 Chain A Binding Site BS01

Receptor Information

>1b01 Chain A (length=43) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ

Ligand information

>1b01 Chain E (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cccgtgcactcaatgcaat

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1b01 The structure of plasmid-encoded transcriptional repressor CopG unliganded and bound to its operator.
Resolution	2.56 Å
Binding residue (original residue number in PDB)	K2 R4 T6 T8 K28 S29
Binding residue (residue number reindexed from 1)	K2 R4 T6 T8 K28 S29

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006276	plasmid maintenance
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0032993	protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1b01, PDBe:1b01, PDBj:1b01
PDBsum	1b01
PubMed	9857196
UniProt	P13920\|COPG_STRAG Protein CopG (Gene Name=copG)

[Back to BioLiP]