Structure of PDB 1b01 Chain A Binding Site BS01

Receptor Information
>1b01 Chain A (length=43) Species: 1311 (Streptococcus agalactiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1b01 The structure of plasmid-encoded transcriptional repressor CopG unliganded and bound to its operator.
Resolution2.56 Å
Binding residue
(original residue number in PDB)		K2 R4 T6 T8 K28 S29
Binding residue
(residue number reindexed from 1)		K2 R4 T6 T8 K28 S29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006276 plasmid maintenance
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1b01, PDBe:1b01, PDBj:1b01
PDBsum1b01
PubMed9857196
UniProtP13920|COPG_STRAG Protein CopG (Gene Name=copG)

[Back to BioLiP]