Structure of PDB 1azq Chain A Binding Site BS01

Receptor Information
>1azq Chain A (length=66) Species: 2285 (Sulfolobus acidocaldarius) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDA
PKELLDMLARAEREKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1azq The hyperthermophile chromosomal protein Sac7d sharply kinks DNA.
Resolution1.94 Å
Binding residue
(original residue number in PDB)		K22 W24 R25 V26 T40 R42
Binding residue
(residue number reindexed from 1)		K22 W24 R25 V26 T40 R42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004521 RNA endonuclease activity
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1azq, PDBe:1azq, PDBj:1azq
PDBsum1azq
PubMed9515968
UniProtP13123|DN7D_SULAC DNA-binding protein 7d (Gene Name=Saci_0064)

[Back to BioLiP]