Structure of PDB 1aze Chain A Binding Site BS01

Receptor Information
>1aze Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEAIAKVDFKATADDELSFKRGDILKVLNEESDQNWYKAELNGKDGFIPK
NYIEMK
Ligand information
>1aze Chain B (length=10) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VPPPVPPRRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aze Molecular and cellular analysis of Grb2 SH3 domain mutants: interaction with Sos and dynamin.
ResolutionN/A
Binding residue
(original residue number in PDB)		D15 E16 D33 N35 W36 N51 Y52
Binding residue
(residue number reindexed from 1)		D15 E16 D33 N35 W36 N51 Y52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1aze, PDBe:1aze, PDBj:1aze
PDBsum1aze
PubMed10395825
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]