Structure of PDB 1ayb Chain A Binding Site BS01

Receptor Information
>1ayb Chain A (length=100) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTH
IKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ayb Crystal structures of peptide complexes of the amino-terminal SH2 domain of the Syp tyrosine phosphatase.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
R32 S34 K35 S36 T42 V51 T52 H53 K55 G67 G68 K89 K91
Binding residue
(residue number reindexed from 1)
R29 S31 K32 S33 T39 V48 T49 H50 K52 G64 G65 K86 K88
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:1ayb, PDBe:1ayb, PDBj:1ayb
PDBsum1ayb
PubMed7521735
UniProtP35235|PTN11_MOUSE Tyrosine-protein phosphatase non-receptor type 11 (Gene Name=Ptpn11)

[Back to BioLiP]