Structure of PDB 1avp Chain A Binding Site BS01

Receptor Information
>1avp Chain A (length=204) Species: 10515 (Human adenovirus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGSSEQELKAIVKDLGCGPYFLGTYDKRFPGFVSPHKLACAIVNTAGRET
GGVHWMAFAWNPRSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASS
PDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLI
TGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCH
LKNM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1avp Crystal structure of the human adenovirus proteinase with its 11 amino acid cofactor.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		D77 R93 R103 C104 I105 T106 L107 E108 K109 S110 T111 Q112 M141 D142 M147 I150 G152
Binding residue
(residue number reindexed from 1)		D77 R93 R103 C104 I105 T106 L107 E108 K109 S110 T111 Q112 M141 D142 M147 I150 G152
Enzymatic activity
Catalytic site (original residue number in PDB) H54 E71 Q115 C122
Catalytic site (residue number reindexed from 1) H54 E71 Q115 C122
Enzyme Commision number 3.4.22.39: adenain.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1avp, PDBe:1avp, PDBj:1avp
PDBsum1avp
PubMed8617222
UniProtP03252|PRO_ADE02 Protease (Gene Name=L3)

[Back to BioLiP]