Structure of PDB 1aud Chain A Binding Site BS01

Receptor Information
>1aud Chain A (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKM
RGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTF
V
Ligand information
>1aud Chain B (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcagaguccuucgggacauugcaccugcc
.<<<<.<<<......>>>.......>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aud Structural basis of the RNA-binding specificity of human U1A protein.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y12 N15 L43 S45 S47 L48 K49 M50 R51 Q53 F55 Y85 A86 K87 D89 S90
Binding residue
(residue number reindexed from 1)		Y12 N15 L43 S45 S47 L48 K49 M50 R51 Q53 F55 Y85 A86 K87 D89 S90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1aud, PDBe:1aud, PDBj:1aud
PDBsum1aud
PubMed9312034
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]