Structure of PDB 1au7 Chain A Binding Site BS01

Receptor Information
>1au7 Chain A (length=130) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQ
LSFKNACKLKAILSKWLEEAEQKRRTTISIAAKDALERHFGEHSKPSSQE
IMRMAEELNLEKEVVRVWFCNRRQREKRVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1au7 Structure of Pit-1 POU domain bound to DNA as a dimer: unexpected arrangement and flexibility.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R20 Q27 Q44 T45 C48 N52 K103 R105 S128 R146 R153 Q154
Binding residue
(residue number reindexed from 1)		R16 Q23 Q40 T41 C44 N48 K73 R75 S98 R116 R123 Q124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1au7, PDBe:1au7, PDBj:1au7
PDBsum1au7
PubMed9009203
UniProtP10037|PIT1_RAT Pituitary-specific positive transcription factor 1 (Gene Name=Pou1f1)

[Back to BioLiP]