Structure of PDB 1aqc Chain A Binding Site BS01

Receptor Information
>1aqc Chain A (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLMT
EVDLFILTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRYKM
ICHVFESEDAQLIAQSIGQAFSVAYQEFLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aqc Sequence-specific recognition of the internalization motif of the Alzheimer's amyloid precursor protein by the X11 PTB domain.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
R353 R414 I416 S417 Y418 I419 A420 R431 M458 A472 Q473 F479 Y483 F486
Binding residue
(residue number reindexed from 1)
R31 R78 I80 S81 Y82 I83 A84 R95 M100 A114 Q115 F121 Y125 F128
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1aqc, PDBe:1aqc, PDBj:1aqc
PDBsum1aqc
PubMed9321393
UniProtQ02410|APBA1_HUMAN Amyloid-beta A4 precursor protein-binding family A member 1 (Gene Name=APBA1)

[Back to BioLiP]