Structure of PDB 1aq3 Chain A Binding Site BS01

Receptor Information
>1aq3 Chain A (length=129) Species: 12022 (Escherichia phage MS2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQ
SSAQNRKYSIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSD
CELIVKAMQGLLKDGNPIPSAIAANSGIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aq3 Crystal structures of MS2 coat protein mutants in complex with wild-type RNA operator fragments.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		T45 C46 S47 R49 S59 K61 E63 Y85
Binding residue
(residue number reindexed from 1)		T45 C46 S47 R49 S59 K61 E63 Y85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
GO:0042802 identical protein binding
Biological Process
GO:0006417 regulation of translation
GO:1904972 negative regulation of viral translation
Cellular Component
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1aq3, PDBe:1aq3, PDBj:1aq3
PDBsum1aq3
PubMed9469847
UniProtP03612|CAPSD_BPMS2 Capsid protein

[Back to BioLiP]