Structure of PDB 1an2 Chain A Binding Site BS01

Receptor Information
>1an2 Chain A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYI
QYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1an2 Recognition by Max of its cognate DNA through a dimeric b/HLH/Z domain.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
N29 E32 R33 R36 S59 R60
Binding residue
(residue number reindexed from 1)
N8 E11 R12 R15 S38 R39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1an2, PDBe:1an2, PDBj:1an2
PDBsum1an2
PubMed8479534
UniProtP61244|MAX_HUMAN Protein max (Gene Name=MAX)

[Back to BioLiP]