Structure of PDB 1am9 Chain A Binding Site BS01

Receptor Information
>1am9 Chain A (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAID
YIRFLQHSNQKLKQENLSLRTAVHKSKSLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1am9 Co-crystal structure of sterol regulatory element binding protein 1a at 2.3 A resolution.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Q319 H328 I331 E332 R334 Y335
Binding residue
(residue number reindexed from 1)		Q1 H10 I13 E14 R16 Y17
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1am9, PDBe:1am9, PDBj:1am9
PDBsum1am9
PubMed9634703
UniProtP36956|SRBP1_HUMAN Sterol regulatory element-binding protein 1 (Gene Name=SREBF1)

[Back to BioLiP]