Structure of PDB 1akh Chain A Binding Site BS01

Receptor Information

>1akh Chain A (length=49) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS

Ligand information

>1akh Chain C (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tacatgtaaaaatttacatca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1akh Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	K100 R115 I119 R122 M123
Binding residue (residue number reindexed from 1)	K24 R39 I43 R46 M47

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1akh, PDBe:1akh, PDBj:1akh
PDBsum	1akh
PubMed	9838003
UniProt	P0CY10\|MATA1_YEASX Mating-type protein A1 (Gene Name=MATA1)

[Back to BioLiP]