Structure of PDB 1ais Chain A Binding Site BS01

Receptor Information
>1ais Chain A (length=181) Species: 2262 (Pyrococcus woesei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVDMSKVKLRIENIVASVDLFAQLDLEKVLDLCPNSKYNPEEFPGIICHL
DDPKVALLIFSSGKLVVTGAKSVQDIERAVAKLAQKLKSIGVKFKRAPQI
DVQNMVFSGDIGREFNLDVVALTLPNCEYEPEQFPGVIYRVKEPKSVILL
FSSGKIVCSGAKSEADAWEAVRKLLRELDKY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ais The 2.1-A crystal structure of an archaeal preinitiation complex: TATA-box-binding protein/transcription factor (II)B core/TATA-box.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		V15 P44 F60 S62 V66 Q103 N104 F134 R140 V147 S159
Binding residue
(residue number reindexed from 1)		V15 P44 F60 S62 V66 Q103 N104 F134 R140 V147 S159
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0140223 general transcription initiation factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ais, PDBe:1ais, PDBj:1ais
PDBsum1ais
PubMed9177165
UniProtP62001|TBP_PYRWO TATA-box-binding protein (Gene Name=tbp)

[Back to BioLiP]