Structure of PDB 1aay Chain A Binding Site BS01

Receptor Information
>1aay Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTT
HIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aay Zif268 protein-DNA complex refined at 1.6 A: a model system for understanding zinc finger-DNA interactions.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R103 R114 F116 R118 E121 R124 H125 I128 R142 R146 H149 H153 T156 R170 R174 R180
Binding residue
(residue number reindexed from 1)		R1 R12 F14 R16 E19 R22 H23 I26 R40 R44 H47 H51 T54 R68 R72 R78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1aay, PDBe:1aay, PDBj:1aay
PDBsum1aay
PubMed8939742
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]