Structure of PDB 1a6y Chain A Binding Site BS01

Receptor Information
>1a6y Chain A (length=78) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIVR
INRNRCQQCRFKKCLSVGMSRDAVRFGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a6y Structural elements of an orphan nuclear receptor-DNA complex.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F111 H112 Y113 K122 R126 R168 V171 R172 F173 R175
Binding residue
(residue number reindexed from 1)		F13 H14 Y15 K24 R28 R71 V74 R75 F76 R78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1a6y, PDBe:1a6y, PDBj:1a6y
PDBsum1a6y
PubMed9660968
UniProtP20393|NR1D1_HUMAN Nuclear receptor subfamily 1 group D member 1 (Gene Name=NR1D1)

[Back to BioLiP]