Structure of PDB 1a6f Chain A Binding Site BS01

Receptor Information

>1a6f Chain A (length=113) Species: 1423 (Bacillus subtilis)

AHLKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDELRVGLSVS
KKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKPASQLTYEETKK
SLQHLFRKSSLYK

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1a6f Chain A Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1a6f Ribonuclease P protein structure: evolutionary origins in the translational apparatus.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): Q38 E40
• Binding residue (residue number reindexed from 1): Q37 E39
• Annotation score: 4

Enzymatic activity

• Enzyme Commision number: 3.1.26.5: ribonuclease P.

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0004526 ribonuclease P activity
• GO:0031404 chloride ion binding
• GO:0033204 ribonuclease P RNA binding
• GO:0042301 phosphate ion binding
• GO:0042781 3'-tRNA processing endoribonuclease activity
• GO:0043168 anion binding
• GO:0043199 sulfate binding
• GO:0060090 molecular adaptor activity

Biological Process

• GO:0001682 tRNA 5'-leader removal
• GO:0008033 tRNA processing
• GO:0042780 tRNA 3'-end processing

Cellular Component

• GO:0030677 ribonuclease P complex

External links

• PDB: RCSB:1a6f, PDBe:1a6f, PDBj:1a6f
• PDBsum: 1a6f
• PubMed: 9563955
• UniProt: P25814|RNPA_BACSU Ribonuclease P protein component (Gene Name=rnpA)