Structure of PDB 1a66 Chain A Binding Site BS01

Receptor Information
>1a66 Chain A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKDWQLPSHSGPYELRIEVQPKSHHRARYETEGSRGAVKASAGGHPIVQL
HGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSN
TKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGETDIGRKNTRVRLV
FRVHVPQPSGRTLSLQVASNPIECSQRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a66 Solution structure of the core NFATC1/DNA complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		R26 R28 R35 G36 K39 R142 Q176
Binding residue
(residue number reindexed from 1)		R26 R28 R35 G36 K39 R142 Q176
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1a66, PDBe:1a66, PDBj:1a66
PDBsum1a66
PubMed9506523
UniProtO95644|NFAC1_HUMAN Nuclear factor of activated T-cells, cytoplasmic 1 (Gene Name=NFATC1)

[Back to BioLiP]