Structure of PDB 1a3q Chain A Binding Site BS01

Receptor Information

>1a3q Chain A (length=285) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYE
GPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNL
GVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMD
LSIVRLRFSAFLRSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRG
GDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTP
PYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYP

Ligand information

>1a3q Chain C (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggggaatcccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1a3q Structure of the human NF-kappaB p52 homodimer-DNA complex at 2.1 A resolution.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	R52 Y55 C57 T142 K143 P223 Q284
Binding residue (residue number reindexed from 1)	R16 Y19 C21 T106 K107 P181 Q242

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1a3q, PDBe:1a3q, PDBj:1a3q
PDBsum	1a3q
PubMed	9384586
UniProt	Q00653\|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit (Gene Name=NFKB2)

[Back to BioLiP]