Structure of PDB 1a1t Chain A Binding Site BS01

Receptor Information
>1a1t Chain A (length=55) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQKGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCT
ERQAN
Ligand information
>1a1t Chain B (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacuagcggaggcuagucc
<<<<<<<<....>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a1t Structure of the HIV-1 nucleocapsid protein bound to the SL3 psi-RNA recognition element.
ResolutionN/A
Binding residue
(original residue number in PDB)		M1 G4 N5 R7 R10 K11 V13 K14 F16 I24 A25 K26 R32 K34 G35 C36 W37 Q45 M46 K47
Binding residue
(residue number reindexed from 1)		M1 G4 N5 R7 R10 K11 V13 K14 F16 I24 A25 K26 R32 K34 G35 C36 W37 Q45 M46 K47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:1a1t, PDBe:1a1t, PDBj:1a1t
PDBsum1a1t
PubMed9430589
UniProtQ75677

[Back to BioLiP]