Structure of PDB 1a1h Chain A Binding Site BS01

Receptor Information
>1a1h Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPYACPVESCDRRFSQSGSLTRHIRIHTGQKPFQCRICMRNFSRSDHLTT
HIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a1h High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		F116 Q118 S121 R124 H125 I128 R142 S145 R146 H149 H153 T156 R174 E177 R180
Binding residue
(residue number reindexed from 1)		F14 Q16 S19 R22 H23 I26 R40 S43 R44 H47 H51 T54 R72 E75 R78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1a1h, PDBe:1a1h, PDBj:1a1h
PDBsum1a1h
PubMed9562555
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]