Structure of PDB 1a1e Chain A Binding Site BS01

Receptor Information
>1a1e Chain A (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFD
NAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLT
TVCP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a1e Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
R158 R178 S180 E181 T182 H204 Y205 K206 T218 G239
Binding residue
(residue number reindexed from 1)
R13 R33 S35 E36 T37 H59 Y60 K61 T73 G94
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1a1e, PDBe:1a1e, PDBj:1a1e
PDBsum1a1e
PubMed9174343
UniProtP12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]