Structure of PDB 1a08 Chain A Binding Site BS01

Receptor Information
>1a08 Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDF
DNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRL
TTVCP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a08 Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
R158 R178 S180 C188 K203 H204 Y205 K206
Binding residue
(residue number reindexed from 1)
R14 R34 S36 C44 K59 H60 Y61 K62
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1a08, PDBe:1a08, PDBj:1a08
PDBsum1a08
PubMed9174343
UniProtP12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]