Structure of PDB 7xxf Chain 9 Binding Site BS01

Receptor Information
>7xxf Chain 9 (length=45) Species: 1071 (Rhodopila globiformis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MWRMWLLFDPRRILVALGVFLFVLALLIHFILLSTDRFNWLDGPH
Ligand information
>7xxf Chain a (length=22) Species: 1071 (Rhodopila globiformis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MAMVWMWILIAPAIGIVLLSRQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xxf An LH1-RC photocomplex from an extremophilic phototroph provides insight into origins of two photosynthesis proteins.
Resolution2.24 Å
Binding residue
(original residue number in PDB)		M1 R3
Binding residue
(residue number reindexed from 1)		M1 R3
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xxf, PDBe:7xxf, PDBj:7xxf
PDBsum7xxf
PubMed36344631
UniProtA0A2S6NEK3

[Back to BioLiP]