Structure of PDB 7q4p Chain 9 Binding Site BS01

Receptor Information

>7q4p Chain 9 (length=101) Species: 9606 (Homo sapiens)

IPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIP
NTAHFANVTQIEDAVSLWAKLKLQKASERWQPDTEEEYEDSSGNVVNKKT
Y

Ligand information

>7q4p Chain 2 (length=45)

ucggccgcuaagauuaguaucuguucuuaucaguuuaauaucuga

..<<<.<<<<....>>>>....>>>....<<<<........>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7q4p Structural basis of branch site recognition by the human spliceosome.
• Resolution: 2.15 Å
• Binding residue (original residue number in PDB): Y394 W395 L396 K398 H400 I404 K420
• Binding residue (residue number reindexed from 1): Y3 W4 L5 K7 H9 I13 K29

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000375 RNA splicing, via transesterification reactions
• GO:0000389 mRNA 3'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0016607 nuclear speck
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:7q4p, PDBe:7q4p, PDBj:7q4p
• PDBsum: 7q4p
• PubMed: 34822310
• UniProt: Q12874|SF3A3_HUMAN Splicing factor 3A subunit 3 (Gene Name=SF3A3)