Structure of PDB 8qxd Chain 8 Binding Site BS01

Receptor Information
>8qxd Chain 8 (length=144) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRVEVKKF
VKIGRPGYKVTKQRDSELFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRR
WQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQ
Ligand information
>8qxd Chain 2 (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcuucucggcaaguguaguaucuguucuuaucaguuuaauaucugauag
auuuuuggagcaucgaccugguauugcaguaccuccaggaacggugc
...............................<<<<.<....>.>>>>...
.........<<<<<<.<<<<<.............>>>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qxd Structural insights into the cross-exon to cross-intron spliceosome switch
Resolution9.6 Å
Binding residue
(original residue number in PDB)		L62 K77
Binding residue
(residue number reindexed from 1)		L21 K36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0010976 positive regulation of neuron projection development
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0016607 nuclear speck
GO:0071004 U2-type prespliceosome
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qxd, PDBe:8qxd, PDBj:8qxd
PDBsum8qxd
PubMed38778104
UniProtQ15428|SF3A2_HUMAN Splicing factor 3A subunit 2 (Gene Name=SF3A2)

[Back to BioLiP]