Structure of PDB 7pt6 Chain 8 Binding Site BS01

Receptor Information
>7pt6 Chain 8 (length=402) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIPPEIKEEMIQLYHDLPGIENEYKLIDKIGEGTFSSVYKAKDITGKITK
KFASHFWNYGSNYVALKKIYVTSSPQRIYNELNLLYIMTGSSRVAPLCDA
KRVRDQVIAVLPYYPHEEFRTFYRDLPIKGIKKYIWELLRALKFVHSKGI
IHRDIKPTNFLFNLELGRGVLVDFGLAEAQMDYKSNHEQFCPCIMRNQYS
VNGVDLTKGYPKNETRRIKRANRAGTRGFRAPEVLMKCGAQSTKIDIWSV
GVILLSLLGRRFPMFQSLDDADSLLELCTIFGWKELRKCAALHGLGFEAS
GLIWDKPNGYSNGLKEFVYDLLNKECTIGTFPEYSVAFETFGFLQQELHD
DAYELKKYQEEIWSDHYWCFQVLEQCFEMDPQKRSSAEDLLKTPFFNELN
EN
Ligand information
>7pt6 Chain 1 (length=4) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pt6 The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G280 T281
Binding residue
(residue number reindexed from 1)		G225 T226
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0042802 identical protein binding
GO:0044024 histone H2AS1 kinase activity
GO:0046872 metal ion binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000727 double-strand break repair via break-induced replication
GO:0001100 negative regulation of exit from mitosis
GO:0006270 DNA replication initiation
GO:0006279 premeiotic DNA replication
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0007165 signal transduction
GO:0016310 phosphorylation
GO:0031503 protein-containing complex localization
GO:0033314 mitotic DNA replication checkpoint signaling
GO:0051301 cell division
GO:0051321 meiotic cell cycle
GO:0060903 positive regulation of meiosis I
GO:1902977 mitotic DNA replication preinitiation complex assembly
GO:1903343 positive regulation of meiotic DNA double-strand break formation
GO:1904968 positive regulation of spindle attachment to meiosis I kinetochore
GO:1905263 positive regulation of meiotic DNA double-strand break formation involved in reciprocal meiotic recombination
GO:1905342 positive regulation of protein localization to kinetochore
GO:1905561 positive regulation of kinetochore assembly
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005813 centrosome
GO:0031431 Dbf4-dependent protein kinase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pt6, PDBe:7pt6, PDBj:7pt6
PDBsum7pt6
PubMed35614055
UniProtP06243|CDC7_YEAST Cell division control protein 7 (Gene Name=CDC7)

[Back to BioLiP]