Structure of PDB 7oib Chain 8 Binding Site BS01

Receptor Information
>7oib Chain 8 (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKME
RDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPP
Ligand information
>7oib Chain B (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga
<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<..>>>.>
>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oib A distinct assembly pathway of the human 39S late pre-mitoribosome.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		F88 L123 K125 Q126 R129
Binding residue
(residue number reindexed from 1)		F6 L41 K43 Q44 R47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0009653 anatomical structure morphogenesis
GO:0032543 mitochondrial translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oib, PDBe:7oib, PDBj:7oib
PDBsum7oib
PubMed34315873
UniProtQ9NQ50|RM40_HUMAN Large ribosomal subunit protein mL40 (Gene Name=MRPL40)

[Back to BioLiP]